SARS-CoV-2 (COVID-19) S Protein, Tag-removed, stabilized trimer Size:100µg

SARS-CoV-2 (COVID-19) S Protein, Tag-removed, stabilized trimer Size:100µgRecombinant Spike protein of SARS CoV 2 (COVID 19) from Wuhan pneumonia virus as a stabilized trimer with deletion of the internal Furin site, C terminal Strep and His Tag removed. The S protein plays key parts in the induction of neutralizing antibody and T cell responses, as well as protective immunity. Overview Product Name: SARS CoV 2 (COVID 19) S Protein, Tag removed stabilized trimer Catalog No.: P2020 029 RefSeq Links: NC_045512. 2; MN908947.

IL-5 and IL-13

IL13RA1 represents a promising therapeutic target

IL-1 beta is involved in a variety of autoimmune and inflammatory diseases caused by enhanced secretion of the cytokine

Programmed death ligand 1 (PD-L1) is considered as crucial immune checkpoint regulator with significant implications in cancer and autoimmune diseases

which results in approximately 160% increased transmissibility of the SARS-CoV-2 virus Gamma variant

the pathogenesis of these neurological disorders remains unclear especially because only low or undetectable levels of SARS-CoV-2 have been reported in human brain specimens

Human Guanylate kinase is the only known enzyme which catalyzes the ATP-dependent phosphorylation of cellular guanosine monophosphate (GMP) into guanosine diphosphate (GDP)

The Cleavage and tag control protein is a versatile protein consisting of various cleavage sites for proteases including TEV

To sort the table

ELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSP

SARS-CoV-2 continues to circulate in the human population necessitating regular booster immunization for its long-term control

such as cathepsins B