human APRIL, MBP/His-Tag Species_SARS-CoV-2; Wuhan seafood market pneumonia virus Mutant (K417T-E484K-N501Y) of SARS-CoV-2 (COVID-19)

Mutant (K417T-E484K-N501Y) of SARS-CoV-2 (COVID-19) Spike S1 from Wuhan pneumonia virus with C-terminal His/GFP-Tag

Product Name: Human Serum Albumin

RBD (Tag-free) binds ACE2 detected by monoclonal antibody CR3022 (conformational antibody)

SNNLDSKVGGNYNYLFRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF

human APRIL, MBP/His-Tag Species_SARS-CoV-2; Wuhan seafood market pneumonia virus Mutant (K417T-E484K-N501Y) of SARS-CoV-2 (COVID-19)A proliferation inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), plays a key role in promoting the survival, proliferation and differentiation of B cells, thereby contributing to the maintenance of humoral immunity. Moreover, APRIL induces class switch recombination to immunoglobulin A (IgA), which is crucial for the generation of mucosal immunity and defense against pathogens at mucosal surfaces.